PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 476235
Common NameARALYDRAFT_476235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 198aa    MW: 22421.4 Da    PI: 9.8361
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
476235genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.7e-153881348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +++++Ed+l+++++++lG++ W++Ia +++ gRt+++++ +w +yl
           476235 38 NFSKDEDDLILKLHALLGNR-WSLIAGRLP-GRTDNEVRIHWETYL 81
                     69******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.51E-171891IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-212885IPR009057Homeodomain-like
PROSITE profilePS5129423.2143185IPR017930Myb domain
SMARTSM007175.7E-143583IPR001005SANT/Myb domain
PfamPF002492.8E-143881IPR001005SANT/Myb domain
CDDcd001671.31E-123881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MNKIRLRALS PPSGMQHRGR RCRLRGRNYV RPEVKQINFS KDEDDLILKL HALLGNRWSL  60
IAGRLPGRTD NEVRIHWETY LKRKLMKMGI DPTNHRLHHH TNYISRRYLN SSHKEHETEI  120
ISDQSSSVSE SCGISTILPI PSTNCSEDST STGRSHLPDL NIALIPTVTS LPARCLQDFS  180
ESSNNGSTGQ ETLLLFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-18198542108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3706090.0AF370609.1 Arabidopsis thaliana putative transcription factor (F23N20.2) mRNA, complete cds.
GenBankAY0482310.0AY048231.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBankAY0870930.0AY087093.1 Arabidopsis thaliana clone 31592 mRNA, complete sequence.
GenBankAY0916970.0AY091697.1 Arabidopsis thaliana At1g71030/F23N20_2 mRNA, complete cds.
GenBankAY5195190.0AY519519.1 Arabidopsis thaliana MYB transcription factor (At1g71030) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888815.11e-145hypothetical protein ARALYDRAFT_476235
TrEMBLD7KYH91e-145D7KYH9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.2__1365__AT1G71030.11e-144(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71030.11e-106MYB-like 2